Placeholder image of a protein
Icon representing a puzzle

2261: Electron Density Reconstruction 26

Closed since about 3 years ago

Novice Overall Prediction Electron Density

Summary


Created
February 02, 2023
Expires
Max points
100
Description

The structure of this protein has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model. This puzzle has a couple copies of two proteins as well as peptides bound, so it will be a bit different than usual.

Sequence
EIKLIKGPKGLGFSIAGGVGNQHIPGDNSIYVTKIIEGGAAHKDGKLQIGDKLLAVNSVCLEEVTHEEAVTALKNTSDFVYLKARRRETQVEIKLIKGPKGLGFSIAGGVGNQHIPGDNSIYVTKIIEGGAAHKDGKLQIGDKLLAVNSVCLEEVTHEEAVTALKNTSDFVYLKARRRETQV

Top groups


  1. Avatar for OmHS 11. OmHS 1 pt. 29,339
  2. Avatar for VeFold 12. VeFold 1 pt. 28,759

  1. Avatar for apetrides 51. apetrides Lv 1 1 pt. 29,018
  2. Avatar for Corvac 52. Corvac Lv 1 1 pt. 28,941
  3. Avatar for abiogenesis 53. abiogenesis Lv 1 1 pt. 28,927
  4. Avatar for Merf 54. Merf Lv 1 1 pt. 28,847
  5. Avatar for Dr.Sillem 55. Dr.Sillem Lv 1 1 pt. 28,759
  6. Avatar for Larini 56. Larini Lv 1 1 pt. 28,737
  7. Avatar for carxo 57. carxo Lv 1 1 pt. 28,706
  8. Avatar for Arne Heessels 58. Arne Heessels Lv 1 1 pt. 28,689
  9. Avatar for mart0258 59. mart0258 Lv 1 1 pt. 28,678
  10. Avatar for evifnoskcaj 60. evifnoskcaj Lv 1 1 pt. 28,651

Comments


MicElephant Lv 1

Why don't you fix the crashes caused by the trim button before posting such puzzles? Problem report existing since months.