Placeholder image of a protein
Icon representing a puzzle

2261: Electron Density Reconstruction 26

Closed since about 3 years ago

Novice Overall Prediction Electron Density

Summary


Created
February 02, 2023
Expires
Max points
100
Description

The structure of this protein has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model. This puzzle has a couple copies of two proteins as well as peptides bound, so it will be a bit different than usual.

Sequence
EIKLIKGPKGLGFSIAGGVGNQHIPGDNSIYVTKIIEGGAAHKDGKLQIGDKLLAVNSVCLEEVTHEEAVTALKNTSDFVYLKARRRETQVEIKLIKGPKGLGFSIAGGVGNQHIPGDNSIYVTKIIEGGAAHKDGKLQIGDKLLAVNSVCLEEVTHEEAVTALKNTSDFVYLKARRRETQV

Top groups


  1. Avatar for OmHS 11. OmHS 1 pt. 29,339
  2. Avatar for VeFold 12. VeFold 1 pt. 28,759

  1. Avatar for Kayceecyr65 61. Kayceecyr65 Lv 1 1 pt. 28,650
  2. Avatar for DScott 62. DScott Lv 1 1 pt. 28,641
  3. Avatar for carsonfb 63. carsonfb Lv 1 1 pt. 28,634
  4. Avatar for Mohoernchen 64. Mohoernchen Lv 1 1 pt. 28,632
  5. Avatar for fordesk 65. fordesk Lv 1 1 pt. 28,590
  6. Avatar for Swapper242 66. Swapper242 Lv 1 1 pt. 28,586
  7. Avatar for pruneau_44 67. pruneau_44 Lv 1 1 pt. 28,583
  8. Avatar for hundborste 68. hundborste Lv 1 1 pt. 28,577
  9. Avatar for furi0us 69. furi0us Lv 1 1 pt. 28,568
  10. Avatar for superfilomeno 70. superfilomeno Lv 1 1 pt. 28,546

Comments


MicElephant Lv 1

Why don't you fix the crashes caused by the trim button before posting such puzzles? Problem report existing since months.