Placeholder image of a protein
Icon representing a puzzle

2261: Electron Density Reconstruction 26

Closed since over 3 years ago

Novice Novice Novice Novice Novice Novice Novice Overall Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction Prediction Electron Density Electron Density Electron Density Electron Density Electron Density Electron Density Electron Density

Summary


Created
February 02, 2023
Expires
Max points
100
Description

The structure of this protein has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model. This puzzle has a couple copies of two proteins as well as peptides bound, so it will be a bit different than usual.

Sequence
EIKLIKGPKGLGFSIAGGVGNQHIPGDNSIYVTKIIEGGAAHKDGKLQIGDKLLAVNSVCLEEVTHEEAVTALKNTSDFVYLKARRRETQVEIKLIKGPKGLGFSIAGGVGNQHIPGDNSIYVTKIIEGGAAHKDGKLQIGDKLLAVNSVCLEEVTHEEAVTALKNTSDFVYLKARRRETQV

Top groups


  1. Avatar for OmHS 11. OmHS 1 pt. 29,339
  2. Avatar for VeFold 12. VeFold 1 pt. 28,759

  1. Avatar for antibot215 71. antibot215 Lv 1 1 pt. 28,410
  2. Avatar for scotj14 72. scotj14 Lv 1 1 pt. 27,281
  3. Avatar for rezaefar 73. rezaefar Lv 1 1 pt. 23,993

Comments


MicElephant Lv 1

Why don't you fix the crashes caused by the trim button before posting such puzzles? Problem report existing since months.