Icon representing a puzzle

2263: Revisiting Puzzle 67: Integrase

Closed since about 3 years ago

Novice Overall Prediction

Summary

Created
February 08, 2023
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This DNA-binding domain is part of a bacterial integrase protein, which facilitates the insertion of new DNA into the bacterial chromosome. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence
EKRRDNRGRILKTGESQRKDGRYLYKYIDSFGEPQFVYSWKLVATDRVPAGKRDCISLREKIAELQKDIHD

Top groups

  1. Avatar for Australia 11. Australia 1 pt. 10,030
  2. Avatar for BOINC@Poland 12. BOINC@Poland 1 pt. 9,832
  3. Avatar for CureCoin 13. CureCoin 1 pt. 9,547
  4. Avatar for Firesign 14. Firesign 1 pt. 8,791
  1. Avatar for MicElephant 11. MicElephant Lv 1 55 pts. 10,371
  2. Avatar for guineapig 12. guineapig Lv 1 52 pts. 10,366
  3. Avatar for BootsMcGraw 13. BootsMcGraw Lv 1 49 pts. 10,363
  4. Avatar for roarshock 14. roarshock Lv 1 45 pts. 10,360
  5. Avatar for NPrincipi 15. NPrincipi Lv 1 43 pts. 10,344
  6. Avatar for WBarme1234 16. WBarme1234 Lv 1 40 pts. 10,330
  7. Avatar for gmn 17. gmn Lv 1 37 pts. 10,321
  8. Avatar for christioanchauvin 18. christioanchauvin Lv 1 35 pts. 10,313
  9. Avatar for g_b 19. g_b Lv 1 32 pts. 10,293
  10. Avatar for fpc 20. fpc Lv 1 30 pts. 10,283

Comments