Icon representing a puzzle

2263: Revisiting Puzzle 67: Integrase

Closed since about 3 years ago

Novice Overall Prediction

Summary

Created
February 08, 2023
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This DNA-binding domain is part of a bacterial integrase protein, which facilitates the insertion of new DNA into the bacterial chromosome. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence
EKRRDNRGRILKTGESQRKDGRYLYKYIDSFGEPQFVYSWKLVATDRVPAGKRDCISLREKIAELQKDIHD

Top groups

  1. Avatar for Anthropic Dreams
    1. Anthropic Dreams
    100 pts. 10,514
  2. Avatar for Go Science 2. Go Science 68 pts. 10,457
  3. Avatar for Contenders 3. Contenders 44 pts. 10,398
  4. Avatar for Void Crushers 4. Void Crushers 27 pts. 10,395
  5. Avatar for FamilyBarmettler 5. FamilyBarmettler 16 pts. 10,330
  6. Avatar for L'Alliance Francophone 6. L'Alliance Francophone 9 pts. 10,313
  7. Avatar for Marvin's bunch 7. Marvin's bunch 5 pts. 10,283
  8. Avatar for Gargleblasters 8. Gargleblasters 3 pts. 10,276
  9. Avatar for AlphaFold 9. AlphaFold 1 pt. 10,045
  10. Avatar for OmHS 10. OmHS 1 pt. 10,042
  1. Avatar for LociOiling
    1. LociOiling Lv 1
    100 pts. 10,513
  2. Avatar for NinjaGreg 2. NinjaGreg Lv 1 95 pts. 10,457
  3. Avatar for Bruno Kestemont 3. Bruno Kestemont Lv 1 90 pts. 10,424
  4. Avatar for Sandrix72 4. Sandrix72 Lv 1 85 pts. 10,401
  5. Avatar for Bletchley Park 5. Bletchley Park Lv 1 80 pts. 10,398
  6. Avatar for dcrwheeler 6. dcrwheeler Lv 1 75 pts. 10,395
  7. Avatar for Timo van der Laan 7. Timo van der Laan Lv 1 71 pts. 10,395
  8. Avatar for BackBuffer 8. BackBuffer Lv 1 67 pts. 10,394
  9. Avatar for grogar7 9. grogar7 Lv 1 63 pts. 10,385
  10. Avatar for Galaxie 10. Galaxie Lv 1 59 pts. 10,380

Comments