Icon representing a puzzle

2263: Revisiting Puzzle 67: Integrase

Closed since about 3 years ago

Novice Overall Prediction

Summary


Created
February 08, 2023
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This DNA-binding domain is part of a bacterial integrase protein, which facilitates the insertion of new DNA into the bacterial chromosome. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence
EKRRDNRGRILKTGESQRKDGRYLYKYIDSFGEPQFVYSWKLVATDRVPAGKRDCISLREKIAELQKDIHD

Top groups


  1. Avatar for Australia 11. Australia 1 pt. 10,030
  2. Avatar for BOINC@Poland 12. BOINC@Poland 1 pt. 9,832
  3. Avatar for CureCoin 13. CureCoin 1 pt. 9,547
  4. Avatar for Firesign 14. Firesign 1 pt. 8,791

  1. Avatar for Deleted player 51. Deleted player 2 pts. 9,786
  2. Avatar for abiogenesis 52. abiogenesis Lv 1 2 pts. 9,755
  3. Avatar for Dr.Sillem 53. Dr.Sillem Lv 1 2 pts. 9,732
  4. Avatar for Skippysk8s 54. Skippysk8s Lv 1 1 pt. 9,726
  5. Avatar for Oransche 55. Oransche Lv 1 1 pt. 9,711
  6. Avatar for rezaefar 56. rezaefar Lv 1 1 pt. 9,694
  7. Avatar for mart0258 57. mart0258 Lv 1 1 pt. 9,676
  8. Avatar for DScott 58. DScott Lv 1 1 pt. 9,662
  9. Avatar for sitlux 59. sitlux Lv 1 1 pt. 9,627
  10. Avatar for Crossed Sticks 60. Crossed Sticks Lv 1 1 pt. 9,616

Comments