Icon representing a puzzle

2263: Revisiting Puzzle 67: Integrase

Closed since about 3 years ago

Novice Novice Overall Overall Prediction Prediction

Summary


Created
February 08, 2023
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This DNA-binding domain is part of a bacterial integrase protein, which facilitates the insertion of new DNA into the bacterial chromosome. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence
EKRRDNRGRILKTGESQRKDGRYLYKYIDSFGEPQFVYSWKLVATDRVPAGKRDCISLREKIAELQKDIHD

Top groups


  1. Avatar for Anthropic Dreams 100 pts. 10,514
  2. Avatar for Go Science 2. Go Science 68 pts. 10,457
  3. Avatar for Contenders 3. Contenders 44 pts. 10,398
  4. Avatar for Void Crushers 4. Void Crushers 27 pts. 10,395
  5. Avatar for FamilyBarmettler 5. FamilyBarmettler 16 pts. 10,330
  6. Avatar for L'Alliance Francophone 6. L'Alliance Francophone 9 pts. 10,313
  7. Avatar for Marvin's bunch 7. Marvin's bunch 5 pts. 10,283
  8. Avatar for Gargleblasters 8. Gargleblasters 3 pts. 10,276
  9. Avatar for AlphaFold 9. AlphaFold 1 pt. 10,045
  10. Avatar for OmHS 10. OmHS 1 pt. 10,042

  1. Avatar for Alistair69 41. Alistair69 Lv 1 5 pts. 9,989
  2. Avatar for ProfVince 42. ProfVince Lv 1 5 pts. 9,951
  3. Avatar for heather-1 43. heather-1 Lv 1 4 pts. 9,930
  4. Avatar for Trajan464 44. Trajan464 Lv 1 4 pts. 9,886
  5. Avatar for Wiz kid 45. Wiz kid Lv 1 4 pts. 9,865
  6. Avatar for carxo 46. carxo Lv 1 3 pts. 9,860
  7. Avatar for ShadowTactics 47. ShadowTactics Lv 1 3 pts. 9,832
  8. Avatar for mnucer 48. mnucer Lv 1 3 pts. 9,827
  9. Avatar for Mack 49. Mack Lv 1 2 pts. 9,793
  10. Avatar for Larini 50. Larini Lv 1 2 pts. 9,787

Comments