Icon representing a puzzle

2263: Revisiting Puzzle 67: Integrase

Closed since about 3 years ago

Novice Novice Novice Overall Overall Overall Prediction Prediction Prediction

Summary


Created
February 08, 2023
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This DNA-binding domain is part of a bacterial integrase protein, which facilitates the insertion of new DNA into the bacterial chromosome. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence
EKRRDNRGRILKTGESQRKDGRYLYKYIDSFGEPQFVYSWKLVATDRVPAGKRDCISLREKIAELQKDIHD

Top groups


  1. Avatar for Anthropic Dreams 100 pts. 10,514
  2. Avatar for Go Science 2. Go Science 68 pts. 10,457
  3. Avatar for Contenders 3. Contenders 44 pts. 10,398
  4. Avatar for Void Crushers 4. Void Crushers 27 pts. 10,395
  5. Avatar for FamilyBarmettler 5. FamilyBarmettler 16 pts. 10,330
  6. Avatar for L'Alliance Francophone 6. L'Alliance Francophone 9 pts. 10,313
  7. Avatar for Marvin's bunch 7. Marvin's bunch 5 pts. 10,283
  8. Avatar for Gargleblasters 8. Gargleblasters 3 pts. 10,276
  9. Avatar for AlphaFold 9. AlphaFold 1 pt. 10,045
  10. Avatar for OmHS 10. OmHS 1 pt. 10,042

  1. Avatar for fiendish_ghoul 61. fiendish_ghoul Lv 1 1 pt. 9,607
  2. Avatar for rosie4loop 62. rosie4loop Lv 1 1 pt. 9,566
  3. Avatar for kotenok2000 63. kotenok2000 Lv 1 1 pt. 9,547
  4. Avatar for frostschutz 64. frostschutz Lv 1 1 pt. 9,536
  5. Avatar for Sharkbait911 65. Sharkbait911 Lv 1 1 pt. 9,511
  6. Avatar for Deleted player 66. Deleted player 1 pt. 9,439
  7. Avatar for RichGuilmain 67. RichGuilmain Lv 1 1 pt. 9,413
  8. Avatar for heyubob 68. heyubob Lv 1 1 pt. 9,381
  9. Avatar for kermyt 69. kermyt Lv 1 1 pt. 9,378
  10. Avatar for Titanus 70. Titanus Lv 1 1 pt. 9,361

Comments