Icon representing a puzzle

2263: Revisiting Puzzle 67: Integrase

Closed since about 3 years ago

Novice Novice Overall Overall Prediction Prediction

Summary


Created
February 08, 2023
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This DNA-binding domain is part of a bacterial integrase protein, which facilitates the insertion of new DNA into the bacterial chromosome. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence
EKRRDNRGRILKTGESQRKDGRYLYKYIDSFGEPQFVYSWKLVATDRVPAGKRDCISLREKIAELQKDIHD

Top groups


  1. Avatar for Anthropic Dreams 100 pts. 10,514
  2. Avatar for Go Science 2. Go Science 68 pts. 10,457
  3. Avatar for Contenders 3. Contenders 44 pts. 10,398
  4. Avatar for Void Crushers 4. Void Crushers 27 pts. 10,395
  5. Avatar for FamilyBarmettler 5. FamilyBarmettler 16 pts. 10,330
  6. Avatar for L'Alliance Francophone 6. L'Alliance Francophone 9 pts. 10,313
  7. Avatar for Marvin's bunch 7. Marvin's bunch 5 pts. 10,283
  8. Avatar for Gargleblasters 8. Gargleblasters 3 pts. 10,276
  9. Avatar for AlphaFold 9. AlphaFold 1 pt. 10,045
  10. Avatar for OmHS 10. OmHS 1 pt. 10,042

  1. Avatar for kommuni 81. kommuni Lv 1 1 pt. 9,188
  2. Avatar for furi0us 82. furi0us Lv 1 1 pt. 9,155
  3. Avatar for greengrass 83. greengrass Lv 1 1 pt. 9,122
  4. Avatar for vyndaquel 84. vyndaquel Lv 1 1 pt. 9,118
  5. Avatar for qwezxc8 85. qwezxc8 Lv 1 1 pt. 8,889
  6. Avatar for Betty Jo Bialosky 86. Betty Jo Bialosky Lv 1 1 pt. 8,791
  7. Avatar for robgee 87. robgee Lv 1 1 pt. 5,743
  8. Avatar for unoboys5 88. unoboys5 Lv 1 1 pt. 3,052
  9. Avatar for COHARR2020 89. COHARR2020 Lv 1 1 pt. 3,038

Comments