Icon representing a puzzle

2265: Revisiting Puzzle 68: Bos Taurus

Closed since about 3 years ago

Novice Novice Novice Novice Novice Novice Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction

Summary


Created
February 15, 2023
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This cow protein, found in epithelial cells of the intestine, binds calcium as it moves from the digestive tract into the blood. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence
KSPEELKGIFEKYAAKEGDPNQLSKEELKLLLQTEFPSLLKGGSTLDELFEELDKNGDGEVSFEEFQVLVKKISQ

Top groups


  1. Avatar for Marvin's bunch 11. Marvin's bunch 1 pt. 10,397
  2. Avatar for CureCoin 12. CureCoin 1 pt. 9,531
  3. Avatar for BOINC@Poland 13. BOINC@Poland 1 pt. 9,518
  4. Avatar for Goons with proteins 14. Goons with proteins 1 pt. 9,019

  1. Avatar for Punzi Baker 3
    1. Punzi Baker 3 Lv 1
    100 pts. 10,759
  2. Avatar for LociOiling 2. LociOiling Lv 1 95 pts. 10,747
  3. Avatar for grogar7 3. grogar7 Lv 1 90 pts. 10,738
  4. Avatar for Bruno Kestemont 4. Bruno Kestemont Lv 1 85 pts. 10,720
  5. Avatar for Sandrix72 5. Sandrix72 Lv 1 80 pts. 10,710
  6. Avatar for bamh 6. bamh Lv 1 75 pts. 10,701
  7. Avatar for Galaxie 7. Galaxie Lv 1 71 pts. 10,700
  8. Avatar for NinjaGreg 8. NinjaGreg Lv 1 67 pts. 10,687
  9. Avatar for MicElephant 9. MicElephant Lv 1 63 pts. 10,623
  10. Avatar for dcrwheeler 10. dcrwheeler Lv 1 59 pts. 10,607

Comments