Icon representing a puzzle

2265: Revisiting Puzzle 68: Bos Taurus

Closed since about 3 years ago

Novice Overall Prediction

Summary

Created
February 15, 2023
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This cow protein, found in epithelial cells of the intestine, binds calcium as it moves from the digestive tract into the blood. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence
KSPEELKGIFEKYAAKEGDPNQLSKEELKLLLQTEFPSLLKGGSTLDELFEELDKNGDGEVSFEEFQVLVKKISQ

Top groups

  1. Avatar for Anthropic Dreams
    1. Anthropic Dreams
    100 pts. 10,750
  2. Avatar for Go Science 2. Go Science 68 pts. 10,722
  3. Avatar for Contenders 3. Contenders 44 pts. 10,623
  4. Avatar for FamilyBarmettler 4. FamilyBarmettler 27 pts. 10,599
  5. Avatar for Void Crushers 5. Void Crushers 16 pts. 10,597
  6. Avatar for L'Alliance Francophone 6. L'Alliance Francophone 9 pts. 10,568
  7. Avatar for Australia 7. Australia 5 pts. 10,517
  8. Avatar for OmHS 8. OmHS 3 pts. 10,480
  9. Avatar for AlphaFold 9. AlphaFold 1 pt. 10,443
  10. Avatar for Gargleblasters 10. Gargleblasters 1 pt. 10,406
  1. Avatar for Punzi Baker 3
    1. Punzi Baker 3 Lv 1
    100 pts. 10,759
  2. Avatar for LociOiling 2. LociOiling Lv 1 95 pts. 10,747
  3. Avatar for grogar7 3. grogar7 Lv 1 90 pts. 10,738
  4. Avatar for Bruno Kestemont 4. Bruno Kestemont Lv 1 85 pts. 10,720
  5. Avatar for Sandrix72 5. Sandrix72 Lv 1 80 pts. 10,710
  6. Avatar for bamh 6. bamh Lv 1 75 pts. 10,701
  7. Avatar for Galaxie 7. Galaxie Lv 1 71 pts. 10,700
  8. Avatar for NinjaGreg 8. NinjaGreg Lv 1 67 pts. 10,687
  9. Avatar for MicElephant 9. MicElephant Lv 1 63 pts. 10,623
  10. Avatar for dcrwheeler 10. dcrwheeler Lv 1 59 pts. 10,607

Comments