Placeholder image of a protein
Icon representing a puzzle

2268: Electron Density Reconstruction 28

Closed since about 3 years ago

Novice Overall Prediction Electron Density

Summary


Created
February 21, 2023
Expires
Max points
100
Description

The structure of this protein has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model. There are two chains in this puzzle that have the same sequence.

Sequence
SDKLELLLDIPLKVTVELGRTRMTLKRVLEMIHGSIIELDKLTGEPVDILVNGKLIARGEVVVIDENFGVRITEIVSPKERLELLNESDKLELLLDIPLKVTVELGRTRMTLKRVLEMIHGSIIELDKLTGEPVDILVNGKLIARGEVVVIDENFGVRITEIVSPKERLELLNE

Top groups


  1. Avatar for Australia 11. Australia 1 pt. 27,449
  2. Avatar for Gargleblasters 12. Gargleblasters 1 pt. 26,868
  3. Avatar for BOINC@Poland 13. BOINC@Poland 1 pt. 26,573
  4. Avatar for SHELL 15. SHELL 1 pt. 18,744
  5. Avatar for Window Group 16. Window Group 1 pt. 10,965

  1. Avatar for TheEclipseOfDoom 31. TheEclipseOfDoom Lv 1 11 pts. 27,520
  2. Avatar for AlphaFold2 32. AlphaFold2 Lv 1 10 pts. 27,482
  3. Avatar for RichGuilmain 33. RichGuilmain Lv 1 9 pts. 27,468
  4. Avatar for AlkiP0Ps 34. AlkiP0Ps Lv 1 8 pts. 27,449
  5. Avatar for blazegeek 35. blazegeek Lv 1 7 pts. 27,415
  6. Avatar for rezaefar 36. rezaefar Lv 1 7 pts. 27,226
  7. Avatar for zbp 37. zbp Lv 1 6 pts. 27,130
  8. Avatar for Wiz kid 38. Wiz kid Lv 1 5 pts. 27,089
  9. Avatar for jausmh 39. jausmh Lv 1 5 pts. 27,059
  10. Avatar for Trajan464 40. Trajan464 Lv 1 4 pts. 27,014

Comments


LociOiling Lv 1

Looks like two chains this time:

sdklellldiplkvtvelgrtrmtlkrvlemihgsiieldkltgepvdilvngkliargevvvidenfgvriteivspkerlell    (1 -  85)
sdklellldiplkvtvelgrtrmtlkrvlemihgsiieldkltgepvdilvngkliargevvvidenfgvriteivspkerlellne (86 - 172)

Once again AA Edit and other recipes fail to detect the chains, but soon….

grogar7 Lv 1

So both the puzzle description and the sequence quoted in the description are incorrect. The chains are not identical. Chain #1 is lacking the 'ne' end. So chain #1 is 85 residues and chain #2 is 87 residues.