Placeholder image of a protein
Icon representing a puzzle

2268: Electron Density Reconstruction 28

Closed since about 3 years ago

Novice Novice Novice Novice Novice Novice Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction Electron Density Electron Density Electron Density Electron Density Electron Density Electron Density

Summary


Created
February 21, 2023
Expires
Max points
100
Description

The structure of this protein has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model. There are two chains in this puzzle that have the same sequence.

Sequence
SDKLELLLDIPLKVTVELGRTRMTLKRVLEMIHGSIIELDKLTGEPVDILVNGKLIARGEVVVIDENFGVRITEIVSPKERLELLNESDKLELLLDIPLKVTVELGRTRMTLKRVLEMIHGSIIELDKLTGEPVDILVNGKLIARGEVVVIDENFGVRITEIVSPKERLELLNE

Top groups


  1. Avatar for Australia 11. Australia 1 pt. 27,449
  2. Avatar for Gargleblasters 12. Gargleblasters 1 pt. 26,868
  3. Avatar for BOINC@Poland 13. BOINC@Poland 1 pt. 26,573
  4. Avatar for SHELL 15. SHELL 1 pt. 18,744
  5. Avatar for Window Group 16. Window Group 1 pt. 10,965

  1. Avatar for nicobul 41. nicobul Lv 1 4 pts. 26,948
  2. Avatar for ProfVince 42. ProfVince Lv 1 4 pts. 26,902
  3. Avatar for Joanna_H 43. Joanna_H Lv 1 3 pts. 26,868
  4. Avatar for rosie4loop 44. rosie4loop Lv 1 3 pts. 26,844
  5. Avatar for roarshock 45. roarshock Lv 1 3 pts. 26,839
  6. Avatar for Sci1017 46. Sci1017 Lv 1 2 pts. 26,802
  7. Avatar for hada 47. hada Lv 1 2 pts. 26,795
  8. Avatar for Kiwegapa 48. Kiwegapa Lv 1 2 pts. 26,739
  9. Avatar for ucad 49. ucad Lv 1 2 pts. 26,637
  10. Avatar for sitlux 50. sitlux Lv 1 2 pts. 26,634

Comments


LociOiling Lv 1

Looks like two chains this time:

sdklellldiplkvtvelgrtrmtlkrvlemihgsiieldkltgepvdilvngkliargevvvidenfgvriteivspkerlell    (1 -  85)
sdklellldiplkvtvelgrtrmtlkrvlemihgsiieldkltgepvdilvngkliargevvvidenfgvriteivspkerlellne (86 - 172)

Once again AA Edit and other recipes fail to detect the chains, but soon….

grogar7 Lv 1

So both the puzzle description and the sequence quoted in the description are incorrect. The chains are not identical. Chain #1 is lacking the 'ne' end. So chain #1 is 85 residues and chain #2 is 87 residues.