Placeholder image of a protein
Icon representing a puzzle

2268: Electron Density Reconstruction 28

Closed since about 3 years ago

Novice Overall Prediction Electron Density

Summary


Created
February 21, 2023
Expires
Max points
100
Description

The structure of this protein has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model. There are two chains in this puzzle that have the same sequence.

Sequence
SDKLELLLDIPLKVTVELGRTRMTLKRVLEMIHGSIIELDKLTGEPVDILVNGKLIARGEVVVIDENFGVRITEIVSPKERLELLNESDKLELLLDIPLKVTVELGRTRMTLKRVLEMIHGSIIELDKLTGEPVDILVNGKLIARGEVVVIDENFGVRITEIVSPKERLELLNE

Top groups


  1. Avatar for Australia 11. Australia 1 pt. 27,449
  2. Avatar for Gargleblasters 12. Gargleblasters 1 pt. 26,868
  3. Avatar for BOINC@Poland 13. BOINC@Poland 1 pt. 26,573
  4. Avatar for SHELL 15. SHELL 1 pt. 18,744
  5. Avatar for Window Group 16. Window Group 1 pt. 10,965

  1. Avatar for Arne Heessels 51. Arne Heessels Lv 1 1 pt. 26,617
  2. Avatar for ShadowTactics 52. ShadowTactics Lv 1 1 pt. 26,573
  3. Avatar for Merf 53. Merf Lv 1 1 pt. 26,551
  4. Avatar for carxo 54. carxo Lv 1 1 pt. 26,334
  5. Avatar for DScott 55. DScott Lv 1 1 pt. 26,305
  6. Avatar for silent gene 56. silent gene Lv 1 1 pt. 26,202
  7. Avatar for Dr.Sillem 57. Dr.Sillem Lv 1 1 pt. 26,015
  8. Avatar for Oransche 58. Oransche Lv 1 1 pt. 25,855
  9. Avatar for CAN1958 59. CAN1958 Lv 1 1 pt. 25,841
  10. Avatar for heyubob 60. heyubob Lv 1 1 pt. 25,761

Comments


LociOiling Lv 1

Looks like two chains this time:

sdklellldiplkvtvelgrtrmtlkrvlemihgsiieldkltgepvdilvngkliargevvvidenfgvriteivspkerlell    (1 -  85)
sdklellldiplkvtvelgrtrmtlkrvlemihgsiieldkltgepvdilvngkliargevvvidenfgvriteivspkerlellne (86 - 172)

Once again AA Edit and other recipes fail to detect the chains, but soon….

grogar7 Lv 1

So both the puzzle description and the sequence quoted in the description are incorrect. The chains are not identical. Chain #1 is lacking the 'ne' end. So chain #1 is 85 residues and chain #2 is 87 residues.