Placeholder image of a protein
Icon representing a puzzle

2268: Electron Density Reconstruction 28

Closed since about 3 years ago

Novice Overall Prediction Electron Density

Summary


Created
February 21, 2023
Expires
Max points
100
Description

The structure of this protein has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model. There are two chains in this puzzle that have the same sequence.

Sequence
SDKLELLLDIPLKVTVELGRTRMTLKRVLEMIHGSIIELDKLTGEPVDILVNGKLIARGEVVVIDENFGVRITEIVSPKERLELLNESDKLELLLDIPLKVTVELGRTRMTLKRVLEMIHGSIIELDKLTGEPVDILVNGKLIARGEVVVIDENFGVRITEIVSPKERLELLNE

Top groups


  1. Avatar for Australia 11. Australia 1 pt. 27,449
  2. Avatar for Gargleblasters 12. Gargleblasters 1 pt. 26,868
  3. Avatar for BOINC@Poland 13. BOINC@Poland 1 pt. 26,573
  4. Avatar for SHELL 15. SHELL 1 pt. 18,744
  5. Avatar for Window Group 16. Window Group 1 pt. 10,965

  1. Avatar for Mohoernchen 61. Mohoernchen Lv 1 1 pt. 25,573
  2. Avatar for Lehrling 62. Lehrling Lv 1 1 pt. 25,382
  3. Avatar for keithv 63. keithv Lv 1 1 pt. 25,374
  4. Avatar for vyndaquel 64. vyndaquel Lv 1 1 pt. 25,360
  5. Avatar for rinze 65. rinze Lv 1 1 pt. 25,352
  6. Avatar for pruneau_44 66. pruneau_44 Lv 1 1 pt. 25,269
  7. Avatar for ZKing 67. ZKing Lv 1 1 pt. 25,263
  8. Avatar for greengrass 68. greengrass Lv 1 1 pt. 25,184
  9. Avatar for eszfrigyes06 69. eszfrigyes06 Lv 1 1 pt. 24,919
  10. Avatar for InariInari2020 70. InariInari2020 Lv 1 1 pt. 24,742

Comments


LociOiling Lv 1

Looks like two chains this time:

sdklellldiplkvtvelgrtrmtlkrvlemihgsiieldkltgepvdilvngkliargevvvidenfgvriteivspkerlell    (1 -  85)
sdklellldiplkvtvelgrtrmtlkrvlemihgsiieldkltgepvdilvngkliargevvvidenfgvriteivspkerlellne (86 - 172)

Once again AA Edit and other recipes fail to detect the chains, but soon….

grogar7 Lv 1

So both the puzzle description and the sequence quoted in the description are incorrect. The chains are not identical. Chain #1 is lacking the 'ne' end. So chain #1 is 85 residues and chain #2 is 87 residues.