Icon representing a puzzle

Beginner Puzzle: Staphylococcus Aureus Electron Density

Closed since over 3 years ago

Beginner Beginner Beginner Beginner Beginner Beginner Beginner Beginner Beginner

Summary


Created
February 27, 2023
Expires
Max points
100
Description

In electron density puzzles, we give you some experimental data to help you find the correct fold. This data takes the form of an electron density, and appears in game as a guide. You can adjust the guide visualization from the Electron Density panel. This is a Beginner puzzle for new players that have joined Foldit in the last 6 months.

Sequence
MEYQLQQLASLTLVGIKETYENGRQAQQHIAGFWQRCYQEGVIADLQLKNNGDLAGILGLCIPELDGKMSYMIAVTGDNSADIAKYDVITLASSKYMVFEAQGAVPKAVQQKMEEVHHYIHQYQANTVKSAPFFELYQDGDTTSEKYITEIWMPVKG

Top groups


No scores of this type to display!


  1. Avatar for rosie4loop
    1. rosie4loop Lv 1
    100 pts. 15,124
  2. Avatar for WuWTq 2. WuWTq Lv 1 33 pts. 14,613
  3. Avatar for vekotov 3. vekotov Lv 1 8 pts. 14,231
  4. Avatar for abbiejeremiah 4. abbiejeremiah Lv 1 2 pts. 13,791
  5. Avatar for tessamaile 5. tessamaile Lv 1 1 pt. 11,405
  6. Avatar for rdwidar 6. rdwidar Lv 1 1 pt. 11,405

Comments