Icon representing a puzzle

2272: Revisiting Puzzle 70: Nucleosome Protein

Closed since about 3 years ago

Novice Overall Prediction

Summary

Created
March 02, 2023
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein domain is a component of the histone protein complex, which packages DNA into compact units called nucleosomes. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence
PHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVALFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA

Top groups

  1. Avatar for BOINC@Poland 11. BOINC@Poland 1 pt. 10,196
  2. Avatar for VeFold 12. VeFold 1 pt. 9,770
  1. Avatar for phi16 11. phi16 Lv 1 45 pts. 10,714
  2. Avatar for BootsMcGraw 12. BootsMcGraw Lv 1 41 pts. 10,704
  3. Avatar for NPrincipi 13. NPrincipi Lv 1 38 pts. 10,704
  4. Avatar for grogar7 14. grogar7 Lv 1 35 pts. 10,699
  5. Avatar for guineapig 15. guineapig Lv 1 31 pts. 10,698
  6. Avatar for akaaka 16. akaaka Lv 1 29 pts. 10,666
  7. Avatar for Punzi Baker 3 17. Punzi Baker 3 Lv 1 26 pts. 10,659
  8. Avatar for Bletchley Park 18. Bletchley Park Lv 1 24 pts. 10,640
  9. Avatar for Joanna_H 19. Joanna_H Lv 1 21 pts. 10,635
  10. Avatar for Timo van der Laan 20. Timo van der Laan Lv 1 19 pts. 10,631

Comments