Icon representing a puzzle

2272: Revisiting Puzzle 70: Nucleosome Protein

Closed since about 3 years ago

Novice Overall Prediction

Summary

Created
March 02, 2023
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein domain is a component of the histone protein complex, which packages DNA into compact units called nucleosomes. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence
PHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVALFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA

Top groups

  1. Avatar for BOINC@Poland 11. BOINC@Poland 1 pt. 10,196
  2. Avatar for VeFold 12. VeFold 1 pt. 9,770
  1. Avatar for alcor29 31. alcor29 Lv 1 6 pts. 10,391
  2. Avatar for g_b 32. g_b Lv 1 5 pts. 10,376
  3. Avatar for strong_base 33. strong_base Lv 1 4 pts. 10,349
  4. Avatar for ProfVince 34. ProfVince Lv 1 4 pts. 10,312
  5. Avatar for AlphaFold2 35. AlphaFold2 Lv 1 3 pts. 10,308
  6. Avatar for nicobul 36. nicobul Lv 1 3 pts. 10,307
  7. Avatar for ucad 37. ucad Lv 1 3 pts. 10,307
  8. Avatar for hada 38. hada Lv 1 2 pts. 10,281
  9. Avatar for heather-1 39. heather-1 Lv 1 2 pts. 10,258
  10. Avatar for Idiotboy 40. Idiotboy Lv 1 2 pts. 10,254

Comments