Icon representing a puzzle

2272: Revisiting Puzzle 70: Nucleosome Protein

Closed since about 3 years ago

Novice Overall Prediction

Summary

Created
March 02, 2023
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein domain is a component of the histone protein complex, which packages DNA into compact units called nucleosomes. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence
PHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVALFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA

Top groups

  1. Avatar for BOINC@Poland 11. BOINC@Poland 1 pt. 10,196
  2. Avatar for VeFold 12. VeFold 1 pt. 9,770
  1. Avatar for Arne Heessels 41. Arne Heessels Lv 1 2 pts. 10,226
  2. Avatar for rosie4loop 42. rosie4loop Lv 1 1 pt. 10,206
  3. Avatar for ShadowTactics 43. ShadowTactics Lv 1 1 pt. 10,196
  4. Avatar for sitlux 44. sitlux Lv 1 1 pt. 10,195
  5. Avatar for Trajan464 45. Trajan464 Lv 1 1 pt. 10,145
  6. Avatar for Wiz kid 46. Wiz kid Lv 1 1 pt. 10,099
  7. Avatar for abiogenesis 47. abiogenesis Lv 1 1 pt. 10,080
  8. Avatar for rezaefar 48. rezaefar Lv 1 1 pt. 10,044
  9. Avatar for DScott 49. DScott Lv 1 1 pt. 10,040
  10. Avatar for Larini 50. Larini Lv 1 1 pt. 10,038

Comments