Icon representing a puzzle

2272: Revisiting Puzzle 70: Nucleosome Protein

Closed since about 3 years ago

Novice Overall Prediction

Summary


Created
March 02, 2023
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein domain is a component of the histone protein complex, which packages DNA into compact units called nucleosomes. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence
PHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVALFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA

Top groups


  1. Avatar for BOINC@Poland 11. BOINC@Poland 1 pt. 10,196
  2. Avatar for VeFold 12. VeFold 1 pt. 9,770

  1. Avatar for Dr.Sillem 51. Dr.Sillem Lv 1 1 pt. 9,934
  2. Avatar for Merf 52. Merf Lv 1 1 pt. 9,926
  3. Avatar for CAN1958 53. CAN1958 Lv 1 1 pt. 9,913
  4. Avatar for fordesk 54. fordesk Lv 1 1 pt. 9,905
  5. Avatar for rinze 55. rinze Lv 1 1 pt. 9,880
  6. Avatar for Mohoernchen 56. Mohoernchen Lv 1 1 pt. 9,837
  7. Avatar for pruneau_44 57. pruneau_44 Lv 1 1 pt. 9,819
  8. Avatar for RWoodcock 58. RWoodcock Lv 1 1 pt. 9,780
  9. Avatar for carxo 59. carxo Lv 1 1 pt. 9,770
  10. Avatar for zbp 60. zbp Lv 1 1 pt. 9,769

Comments