Icon representing a puzzle

2272: Revisiting Puzzle 70: Nucleosome Protein

Closed since about 3 years ago

Novice Novice Novice Novice Novice Novice Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction

Summary


Created
March 02, 2023
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein domain is a component of the histone protein complex, which packages DNA into compact units called nucleosomes. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence
PHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVALFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA

Top groups


  1. Avatar for BOINC@Poland 11. BOINC@Poland 1 pt. 10,196
  2. Avatar for VeFold 12. VeFold 1 pt. 9,770

  1. Avatar for vekotov 61. vekotov Lv 1 1 pt. 9,757
  2. Avatar for Swapper242 62. Swapper242 Lv 1 1 pt. 9,681
  3. Avatar for Don Sweik 64. Don Sweik Lv 1 1 pt. 9,530
  4. Avatar for Sammy3c2b1a0 65. Sammy3c2b1a0 Lv 1 1 pt. 9,338
  5. Avatar for WuWTq 66. WuWTq Lv 1 1 pt. 8,192
  6. Avatar for dexterone 67. dexterone Lv 1 1 pt. 7,729
  7. Avatar for rdwidar 68. rdwidar Lv 1 1 pt. 3,850

Comments