Placeholder image of a protein
Icon representing a puzzle

2277: Electron Density Reconstruction 31

Closed since almost 3 years ago

Novice Overall Prediction Electron Density

Summary

Created
March 10, 2023
Expires
Max points
100
Description

The structure of this protein has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model.

Sequence
MEWLVKKSCCNKQDNRHVLMLCDAGGAIKMIAEVKSDFAVKVGDLLSPLQNALYCINREKLHTVKVLSASSYSPDEWERQCKVAG

Top groups

  1. Avatar for Tableau ACE 11. Tableau ACE 2 pts. 17,253
  2. Avatar for Andrew's Foldit group 12. Andrew's Foldit group 1 pt. 17,184
  3. Avatar for VeFold 13. VeFold 1 pt. 17,113
  4. Avatar for AlphaFold 14. AlphaFold 1 pt. 16,973
  5. Avatar for Rechenkraft.net 15. Rechenkraft.net 1 pt. 16,758
  6. Avatar for Street Smarts 16. Street Smarts 1 pt. 16,753
  7. Avatar for SETI.Germany 17. SETI.Germany 1 pt. 12,413
  8. Avatar for SHELL 18. SHELL 1 pt. 12,064
  1. Avatar for BardiKnowledge 81. BardiKnowledge Lv 1 1 pt. 12,064
  2. Avatar for albatrit8392 82. albatrit8392 Lv 1 1 pt. 12,064
  3. Avatar for spvincent 83. spvincent Lv 1 1 pt. 12,064
  4. Avatar for 42007056 84. 42007056 Lv 1 1 pt. 12,064

Comments