2277: Electron Density Reconstruction 31

Closed since almost 3 years ago

Summary

• Created: March 10, 2023
• Expires: March 23, 2023 at 18:00 UTC
• Max points: 100

Description

The structure of this protein has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model.

• Sequence: MEWLVKKSCCNKQDNRHVLMLCDAGGAIKMIAEVKSDFAVKVGDLLSPLQNALYCINREKLHTVKVLSASSYSPDEWERQCKVAG

Top groups

• 1. Go Science 100 pts. 17,757
• 2. Anthropic Dreams 74 pts. 17,745
• 3. Contenders 54 pts. 17,685
• 4. Void Crushers 38 pts. 17,654
• 5. Marvin's bunch 27 pts. 17,654
• 6. FamilyBarmettler 18 pts. 17,624
• 7. Australia 12 pts. 17,618
• 8. L'Alliance Francophone 8 pts. 17,613
• 9. BOINC@Poland 5 pts. 17,484
• 10. Trinity Biology 3 pts. 17,290

Top soloists

• 1. Sandrix72 100 pts. 17,754
• 2. Bruno Kestemont 95 pts. 17,740
• 3. grogar7 89 pts. 17,723
• 4. Galaxie 84 pts. 17,722
• 5. Punzi Baker 3 79 pts. 17,719
• 6. LociOiling 74 pts. 17,707
• 7. Steven Pletsch 69 pts. 17,694
• 8. dcrwheeler 65 pts. 17,693
• 9. phi16 61 pts. 17,689
• 10. gmn 57 pts. 17,685