Placeholder image of a protein
Icon representing a puzzle

2277: Electron Density Reconstruction 31

Closed since about 3 years ago

Novice Novice Novice Overall Overall Overall Prediction Prediction Prediction Electron Density Electron Density Electron Density

Summary


Created
March 10, 2023
Expires
Max points
100
Description

The structure of this protein has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model.

Sequence
MEWLVKKSCCNKQDNRHVLMLCDAGGAIKMIAEVKSDFAVKVGDLLSPLQNALYCINREKLHTVKVLSASSYSPDEWERQCKVAG

Top groups


  1. Avatar for Go Science 100 pts. 17,757
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 74 pts. 17,745
  3. Avatar for Contenders 3. Contenders 54 pts. 17,685
  4. Avatar for Void Crushers 4. Void Crushers 38 pts. 17,654
  5. Avatar for Marvin's bunch 5. Marvin's bunch 27 pts. 17,654
  6. Avatar for FamilyBarmettler 6. FamilyBarmettler 18 pts. 17,624
  7. Avatar for Australia 7. Australia 12 pts. 17,618
  8. Avatar for L'Alliance Francophone 8. L'Alliance Francophone 8 pts. 17,613
  9. Avatar for BOINC@Poland 9. BOINC@Poland 5 pts. 17,484
  10. Avatar for Trinity Biology 10. Trinity Biology 3 pts. 17,290

  1. Avatar for Sandrix72
    1. Sandrix72 Lv 1
    100 pts. 17,754
  2. Avatar for Bruno Kestemont 2. Bruno Kestemont Lv 1 95 pts. 17,740
  3. Avatar for grogar7 3. grogar7 Lv 1 89 pts. 17,723
  4. Avatar for Galaxie 4. Galaxie Lv 1 84 pts. 17,722
  5. Avatar for Punzi Baker 3 5. Punzi Baker 3 Lv 1 79 pts. 17,719
  6. Avatar for LociOiling 6. LociOiling Lv 1 74 pts. 17,707
  7. Avatar for Steven Pletsch 7. Steven Pletsch Lv 1 69 pts. 17,694
  8. Avatar for dcrwheeler 8. dcrwheeler Lv 1 65 pts. 17,693
  9. Avatar for phi16 9. phi16 Lv 1 61 pts. 17,689
  10. Avatar for gmn 10. gmn Lv 1 57 pts. 17,685

Comments