Icon representing a puzzle

2283: Revisiting Puzzle 73: Polycystein

Closed since almost 3 years ago

Novice Overall Prediction

Summary

Created
March 29, 2023
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This domain is a component of a large glycoprotein in humans that has been linked to autosomal dominant polycystic kidney disease. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence
ATLVGPHGPLASGQLAAFHIAAPLPVTATRWDFGDGSAEVDAAGPAASHRYVLPGRYHVTAVLALGAGSALLGTDVQVEA

Top groups

  1. Avatar for Q3 - Bioteknologi Protein 11. Q3 - Bioteknologi Protein 1 pt. 8,262
  2. Avatar for Team China 12. Team China 1 pt. 7,701
  3. Avatar for SHELL 13. SHELL 1 pt. 4,879
  1. Avatar for blazegeek 11. blazegeek Lv 1 52 pts. 10,393
  2. Avatar for fpc 12. fpc Lv 1 48 pts. 10,378
  3. Avatar for Galaxie 13. Galaxie Lv 1 45 pts. 10,331
  4. Avatar for akaaka 14. akaaka Lv 1 42 pts. 10,318
  5. Avatar for g_b 15. g_b Lv 1 39 pts. 10,315
  6. Avatar for christioanchauvin 16. christioanchauvin Lv 1 36 pts. 10,214
  7. Avatar for alcor29 17. alcor29 Lv 1 33 pts. 10,166
  8. Avatar for drjr 18. drjr Lv 1 31 pts. 10,156
  9. Avatar for NPrincipi 19. NPrincipi Lv 1 28 pts. 10,136
  10. Avatar for WBarme1234 20. WBarme1234 Lv 1 26 pts. 10,051

Comments