Icon representing a puzzle

2283: Revisiting Puzzle 73: Polycystein

Closed since about 3 years ago

Novice Overall Prediction

Summary


Created
March 29, 2023
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This domain is a component of a large glycoprotein in humans that has been linked to autosomal dominant polycystic kidney disease. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence
ATLVGPHGPLASGQLAAFHIAAPLPVTATRWDFGDGSAEVDAAGPAASHRYVLPGRYHVTAVLALGAGSALLGTDVQVEA

Top groups


  1. Avatar for Team China 12. Team China 1 pt. 7,701
  2. Avatar for SHELL 13. SHELL 1 pt. 4,879

  1. Avatar for Punzi Baker 3 21. Punzi Baker 3 Lv 1 24 pts. 10,030
  2. Avatar for BootsMcGraw 22. BootsMcGraw Lv 1 22 pts. 9,988
  3. Avatar for Bletchley Park 23. Bletchley Park Lv 1 21 pts. 9,979
  4. Avatar for BackBuffer 24. BackBuffer Lv 1 19 pts. 9,976
  5. Avatar for AlkiP0Ps 25. AlkiP0Ps Lv 1 17 pts. 9,972
  6. Avatar for maithra 26. maithra Lv 1 16 pts. 9,966
  7. Avatar for Vinara 27. Vinara Lv 1 15 pts. 9,925
  8. Avatar for roarshock 28. roarshock Lv 1 13 pts. 9,916
  9. Avatar for guineapig 29. guineapig Lv 1 12 pts. 9,886
  10. Avatar for ProfVince 30. ProfVince Lv 1 11 pts. 9,859

Comments