Icon representing a puzzle

2283: Revisiting Puzzle 73: Polycystein

Closed since almost 3 years ago

Novice Overall Prediction

Summary


Created
March 29, 2023
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This domain is a component of a large glycoprotein in humans that has been linked to autosomal dominant polycystic kidney disease. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence
ATLVGPHGPLASGQLAAFHIAAPLPVTATRWDFGDGSAEVDAAGPAASHRYVLPGRYHVTAVLALGAGSALLGTDVQVEA

Top groups


  1. Avatar for Team China 12. Team China 1 pt. 7,701
  2. Avatar for SHELL 13. SHELL 1 pt. 4,879

  1. Avatar for johngran 41. johngran Lv 1 4 pts. 9,569
  2. Avatar for Trajan464 42. Trajan464 Lv 1 3 pts. 9,566
  3. Avatar for rosie4loop 43. rosie4loop Lv 1 3 pts. 9,473
  4. Avatar for AcruxVega 44. AcruxVega Lv 1 3 pts. 9,426
  5. Avatar for Oransche 45. Oransche Lv 1 2 pts. 9,417
  6. Avatar for abiogenesis 46. abiogenesis Lv 1 2 pts. 9,364
  7. Avatar for Arne Heessels 47. Arne Heessels Lv 1 2 pts. 9,347
  8. Avatar for carxo 48. carxo Lv 1 2 pts. 9,321
  9. Avatar for DScott 49. DScott Lv 1 2 pts. 9,317
  10. Avatar for bamh 50. bamh Lv 1 1 pt. 9,316

Comments