Icon representing a puzzle

2283: Revisiting Puzzle 73: Polycystein

Closed since almost 3 years ago

Novice Overall Prediction

Summary


Created
March 29, 2023
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This domain is a component of a large glycoprotein in humans that has been linked to autosomal dominant polycystic kidney disease. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence
ATLVGPHGPLASGQLAAFHIAAPLPVTATRWDFGDGSAEVDAAGPAASHRYVLPGRYHVTAVLALGAGSALLGTDVQVEA

Top groups


  1. Avatar for Team China 12. Team China 1 pt. 7,701
  2. Avatar for SHELL 13. SHELL 1 pt. 4,879

  1. Avatar for alyssa_d_V2.0 51. alyssa_d_V2.0 Lv 1 1 pt. 9,264
  2. Avatar for ucad 52. ucad Lv 1 1 pt. 9,261
  3. Avatar for zbp 53. zbp Lv 1 1 pt. 9,248
  4. Avatar for Dr.Sillem 54. Dr.Sillem Lv 1 1 pt. 9,247
  5. Avatar for Wanderer09 55. Wanderer09 Lv 1 1 pt. 9,240
  6. Avatar for RichGuilmain 56. RichGuilmain Lv 1 1 pt. 9,204
  7. Avatar for rinze 58. rinze Lv 1 1 pt. 8,959
  8. Avatar for Deleted player 59. Deleted player 1 pt. 8,919
  9. Avatar for Larini 60. Larini Lv 1 1 pt. 8,838

Comments