Placeholder image of a protein
Icon representing a puzzle

2286: Electron Density Reconstruction 34

Closed since about 3 years ago

Novice Novice Overall Overall Prediction Prediction Electron Density Electron Density

Summary

Created
April 03, 2023
Expires
Max points
100
Description

The structure of this protein has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model.

Sequence
SPTSILDIRQGPKEPFRDYVDRFYKTLRAEQASQEVKNWMTETLLVQNANPDSKTILKALGPGATLEEMMTACQGVGGPGHKARVL

Top groups

  1. Avatar for Street Smarts 11. Street Smarts 1 pt. 14,971
  2. Avatar for Q3 - Bioteknologi Protein 12. Q3 - Bioteknologi Protein 1 pt. 14,836
  3. Avatar for SHELL 13. SHELL 1 pt. 9,856
  1. Avatar for roarshock 31. roarshock Lv 1 9 pts. 15,365
  2. Avatar for equilibria 32. equilibria Lv 1 8 pts. 15,363
  3. Avatar for Anfinsen_slept_here 33. Anfinsen_slept_here Lv 1 8 pts. 15,341
  4. Avatar for ShadowTactics 34. ShadowTactics Lv 1 7 pts. 15,332
  5. Avatar for zbp 35. zbp Lv 1 6 pts. 15,325
  6. Avatar for ProfVince 36. ProfVince Lv 1 6 pts. 15,319
  7. Avatar for NPrincipi 37. NPrincipi Lv 1 5 pts. 15,309
  8. Avatar for Trajan464 38. Trajan464 Lv 1 5 pts. 15,309
  9. Avatar for hansvandenhof 39. hansvandenhof Lv 1 4 pts. 15,306
  10. Avatar for Oransche 40. Oransche Lv 1 4 pts. 15,305

Comments