Placeholder image of a protein
Icon representing a puzzle

2286: Electron Density Reconstruction 34

Closed since almost 3 years ago

Novice Overall Prediction Electron Density

Summary

Created
April 03, 2023
Expires
Max points
100
Description

The structure of this protein has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model.

Sequence
SPTSILDIRQGPKEPFRDYVDRFYKTLRAEQASQEVKNWMTETLLVQNANPDSKTILKALGPGATLEEMMTACQGVGGPGHKARVL

Top groups

  1. Avatar for Go Science
    1. Go Science
    100 pts. 15,466
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 65 pts. 15,462
  3. Avatar for Contenders 3. Contenders 41 pts. 15,444
  4. Avatar for L'Alliance Francophone 4. L'Alliance Francophone 24 pts. 15,443
  5. Avatar for Marvin's bunch 5. Marvin's bunch 14 pts. 15,413
  6. Avatar for Australia 6. Australia 7 pts. 15,409
  7. Avatar for FamilyBarmettler 7. FamilyBarmettler 4 pts. 15,376
  8. Avatar for BOINC@Poland 8. BOINC@Poland 2 pts. 15,332
  9. Avatar for Gargleblasters 9. Gargleblasters 1 pt. 15,200
  10. Avatar for VeFold 10. VeFold 1 pt. 15,064
  1. Avatar for Sandrix72
    1. Sandrix72 Lv 1
    100 pts. 15,466
  2. Avatar for LociOiling 2. LociOiling Lv 1 94 pts. 15,454
  3. Avatar for NinjaGreg 3. NinjaGreg Lv 1 88 pts. 15,447
  4. Avatar for dcrwheeler 4. dcrwheeler Lv 1 83 pts. 15,446
  5. Avatar for Galaxie 5. Galaxie Lv 1 77 pts. 15,445
  6. Avatar for MicElephant 6. MicElephant Lv 1 72 pts. 15,444
  7. Avatar for christioanchauvin 7. christioanchauvin Lv 1 68 pts. 15,443
  8. Avatar for gmn 8. gmn Lv 1 63 pts. 15,441
  9. Avatar for Bruno Kestemont 9. Bruno Kestemont Lv 1 59 pts. 15,432
  10. Avatar for silent gene 10. silent gene Lv 1 55 pts. 15,431

Comments