Placeholder image of a protein
Icon representing a puzzle

2286: Electron Density Reconstruction 34

Closed since almost 3 years ago

Novice Overall Prediction Electron Density

Summary

Created
April 03, 2023
Expires
Max points
100
Description

The structure of this protein has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model.

Sequence
SPTSILDIRQGPKEPFRDYVDRFYKTLRAEQASQEVKNWMTETLLVQNANPDSKTILKALGPGATLEEMMTACQGVGGPGHKARVL

Top groups

  1. Avatar for Street Smarts 11. Street Smarts 1 pt. 14,971
  2. Avatar for Q3 - Bioteknologi Protein 12. Q3 - Bioteknologi Protein 1 pt. 14,836
  3. Avatar for SHELL 13. SHELL 1 pt. 9,856
  1. Avatar for firaysyam 71. firaysyam Lv 1 1 pt. 14,836
  2. Avatar for konikula 72. konikula Lv 1 1 pt. 14,833
  3. Avatar for B. A. Beder 73. B. A. Beder Lv 1 1 pt. 14,704
  4. Avatar for Dikkebaap 74. Dikkebaap Lv 1 1 pt. 14,453
  5. Avatar for deathbat_87 75. deathbat_87 Lv 1 1 pt. 14,410
  6. Avatar for spvincent 76. spvincent Lv 1 1 pt. 14,408
  7. Avatar for U202143311 77. U202143311 Lv 1 1 pt. 9,856
  8. Avatar for U202143303 78. U202143303 Lv 1 1 pt. 9,836
  9. Avatar for fatma fattihul inayah 79. fatma fattihul inayah Lv 1 1 pt. 9,806
  10. Avatar for asvaaron 80. asvaaron Lv 1 1 pt. 9,806

Comments