Placeholder image of a protein
Icon representing a puzzle

2286: Electron Density Reconstruction 34

Closed since about 3 years ago

Novice Novice Overall Overall Prediction Prediction Electron Density Electron Density

Summary


Created
April 03, 2023
Expires
Max points
100
Description

The structure of this protein has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model.

Sequence
SPTSILDIRQGPKEPFRDYVDRFYKTLRAEQASQEVKNWMTETLLVQNANPDSKTILKALGPGATLEEMMTACQGVGGPGHKARVL

Top groups


  1. Avatar for Go Science 100 pts. 15,466
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 65 pts. 15,462
  3. Avatar for Contenders 3. Contenders 41 pts. 15,444
  4. Avatar for L'Alliance Francophone 4. L'Alliance Francophone 24 pts. 15,443
  5. Avatar for Marvin's bunch 5. Marvin's bunch 14 pts. 15,413
  6. Avatar for Australia 6. Australia 7 pts. 15,409
  7. Avatar for FamilyBarmettler 7. FamilyBarmettler 4 pts. 15,376
  8. Avatar for BOINC@Poland 8. BOINC@Poland 2 pts. 15,332
  9. Avatar for Gargleblasters 9. Gargleblasters 1 pt. 15,200
  10. Avatar for VeFold 10. VeFold 1 pt. 15,064

  1. Avatar for phi16 11. phi16 Lv 1 51 pts. 15,429
  2. Avatar for BootsMcGraw 12. BootsMcGraw Lv 1 47 pts. 15,420
  3. Avatar for akaaka 13. akaaka Lv 1 44 pts. 15,416
  4. Avatar for drjr 14. drjr Lv 1 41 pts. 15,415
  5. Avatar for guineapig 15. guineapig Lv 1 38 pts. 15,414
  6. Avatar for fpc 16. fpc Lv 1 35 pts. 15,413
  7. Avatar for AlkiP0Ps 17. AlkiP0Ps Lv 1 32 pts. 15,409
  8. Avatar for alcor29 18. alcor29 Lv 1 30 pts. 15,400
  9. Avatar for Punzi Baker 3 19. Punzi Baker 3 Lv 1 27 pts. 15,398
  10. Avatar for Bletchley Park 20. Bletchley Park Lv 1 25 pts. 15,397

Comments