Placeholder image of a protein
Icon representing a puzzle

2286: Electron Density Reconstruction 34

Closed since about 3 years ago

Novice Novice Overall Overall Prediction Prediction Electron Density Electron Density

Summary


Created
April 03, 2023
Expires
Max points
100
Description

The structure of this protein has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model.

Sequence
SPTSILDIRQGPKEPFRDYVDRFYKTLRAEQASQEVKNWMTETLLVQNANPDSKTILKALGPGATLEEMMTACQGVGGPGHKARVL

Top groups


  1. Avatar for Go Science 100 pts. 15,466
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 65 pts. 15,462
  3. Avatar for Contenders 3. Contenders 41 pts. 15,444
  4. Avatar for L'Alliance Francophone 4. L'Alliance Francophone 24 pts. 15,443
  5. Avatar for Marvin's bunch 5. Marvin's bunch 14 pts. 15,413
  6. Avatar for Australia 6. Australia 7 pts. 15,409
  7. Avatar for FamilyBarmettler 7. FamilyBarmettler 4 pts. 15,376
  8. Avatar for BOINC@Poland 8. BOINC@Poland 2 pts. 15,332
  9. Avatar for Gargleblasters 9. Gargleblasters 1 pt. 15,200
  10. Avatar for VeFold 10. VeFold 1 pt. 15,064

  1. Avatar for roarshock 31. roarshock Lv 1 9 pts. 15,365
  2. Avatar for equilibria 32. equilibria Lv 1 8 pts. 15,363
  3. Avatar for Anfinsen_slept_here 33. Anfinsen_slept_here Lv 1 8 pts. 15,341
  4. Avatar for ShadowTactics 34. ShadowTactics Lv 1 7 pts. 15,332
  5. Avatar for zbp 35. zbp Lv 1 6 pts. 15,325
  6. Avatar for ProfVince 36. ProfVince Lv 1 6 pts. 15,319
  7. Avatar for NPrincipi 37. NPrincipi Lv 1 5 pts. 15,309
  8. Avatar for Trajan464 38. Trajan464 Lv 1 5 pts. 15,309
  9. Avatar for hansvandenhof 39. hansvandenhof Lv 1 4 pts. 15,306
  10. Avatar for Oransche 40. Oransche Lv 1 4 pts. 15,305

Comments