Placeholder image of a protein
Icon representing a puzzle

2286: Electron Density Reconstruction 34

Closed since about 3 years ago

Novice Novice Overall Overall Prediction Prediction Electron Density Electron Density

Summary


Created
April 03, 2023
Expires
Max points
100
Description

The structure of this protein has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model.

Sequence
SPTSILDIRQGPKEPFRDYVDRFYKTLRAEQASQEVKNWMTETLLVQNANPDSKTILKALGPGATLEEMMTACQGVGGPGHKARVL

Top groups


  1. Avatar for Go Science 100 pts. 15,466
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 65 pts. 15,462
  3. Avatar for Contenders 3. Contenders 41 pts. 15,444
  4. Avatar for L'Alliance Francophone 4. L'Alliance Francophone 24 pts. 15,443
  5. Avatar for Marvin's bunch 5. Marvin's bunch 14 pts. 15,413
  6. Avatar for Australia 6. Australia 7 pts. 15,409
  7. Avatar for FamilyBarmettler 7. FamilyBarmettler 4 pts. 15,376
  8. Avatar for BOINC@Poland 8. BOINC@Poland 2 pts. 15,332
  9. Avatar for Gargleblasters 9. Gargleblasters 1 pt. 15,200
  10. Avatar for VeFold 10. VeFold 1 pt. 15,064

  1. Avatar for ucad 41. ucad Lv 1 3 pts. 15,302
  2. Avatar for matt61ger 42. matt61ger Lv 1 3 pts. 15,295
  3. Avatar for muffnerk 43. muffnerk Lv 1 3 pts. 15,293
  4. Avatar for hada 44. hada Lv 1 2 pts. 15,274
  5. Avatar for Wiz kid 45. Wiz kid Lv 1 2 pts. 15,274
  6. Avatar for blazegeek 46. blazegeek Lv 1 2 pts. 15,254
  7. Avatar for sitlux 47. sitlux Lv 1 2 pts. 15,221
  8. Avatar for tomespen 48. tomespen Lv 1 1 pt. 15,200
  9. Avatar for Vinara 49. Vinara Lv 1 1 pt. 15,161
  10. Avatar for Merf 50. Merf Lv 1 1 pt. 15,113

Comments