Placeholder image of a protein
Icon representing a puzzle

2286: Electron Density Reconstruction 34

Closed since about 3 years ago

Novice Novice Overall Overall Prediction Prediction Electron Density Electron Density

Summary


Created
April 03, 2023
Expires
Max points
100
Description

The structure of this protein has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model.

Sequence
SPTSILDIRQGPKEPFRDYVDRFYKTLRAEQASQEVKNWMTETLLVQNANPDSKTILKALGPGATLEEMMTACQGVGGPGHKARVL

Top groups


  1. Avatar for Go Science 100 pts. 15,466
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 65 pts. 15,462
  3. Avatar for Contenders 3. Contenders 41 pts. 15,444
  4. Avatar for L'Alliance Francophone 4. L'Alliance Francophone 24 pts. 15,443
  5. Avatar for Marvin's bunch 5. Marvin's bunch 14 pts. 15,413
  6. Avatar for Australia 6. Australia 7 pts. 15,409
  7. Avatar for FamilyBarmettler 7. FamilyBarmettler 4 pts. 15,376
  8. Avatar for BOINC@Poland 8. BOINC@Poland 2 pts. 15,332
  9. Avatar for Gargleblasters 9. Gargleblasters 1 pt. 15,200
  10. Avatar for VeFold 10. VeFold 1 pt. 15,064

  1. Avatar for tolan_lord 61. tolan_lord Lv 1 1 pt. 14,959
  2. Avatar for Swapper242 62. Swapper242 Lv 1 1 pt. 14,955
  3. Avatar for User098123 63. User098123 Lv 1 1 pt. 14,951
  4. Avatar for WuWTq 64. WuWTq Lv 1 1 pt. 14,950
  5. Avatar for apetrides 65. apetrides Lv 1 1 pt. 14,949
  6. Avatar for Mohoernchen 66. Mohoernchen Lv 1 1 pt. 14,934
  7. Avatar for Jackd4w 67. Jackd4w Lv 1 1 pt. 14,901
  8. Avatar for pruneau_44 68. pruneau_44 Lv 1 1 pt. 14,893
  9. Avatar for furi0us 69. furi0us Lv 1 1 pt. 14,893
  10. Avatar for carxo 70. carxo Lv 1 1 pt. 14,888

Comments