Placeholder image of a protein
Icon representing a puzzle

2286: Electron Density Reconstruction 34

Closed since almost 3 years ago

Novice Overall Prediction Electron Density

Summary

Created
April 03, 2023
Expires
Max points
100
Description

The structure of this protein has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model.

Sequence
SPTSILDIRQGPKEPFRDYVDRFYKTLRAEQASQEVKNWMTETLLVQNANPDSKTILKALGPGATLEEMMTACQGVGGPGHKARVL

Top groups

  1. Avatar for Go Science
    1. Go Science
    100 pts. 15,466
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 65 pts. 15,462
  3. Avatar for Contenders 3. Contenders 41 pts. 15,444
  4. Avatar for L'Alliance Francophone 4. L'Alliance Francophone 24 pts. 15,443
  5. Avatar for Marvin's bunch 5. Marvin's bunch 14 pts. 15,413
  6. Avatar for Australia 6. Australia 7 pts. 15,409
  7. Avatar for FamilyBarmettler 7. FamilyBarmettler 4 pts. 15,376
  8. Avatar for BOINC@Poland 8. BOINC@Poland 2 pts. 15,332
  9. Avatar for Gargleblasters 9. Gargleblasters 1 pt. 15,200
  10. Avatar for VeFold 10. VeFold 1 pt. 15,064
  1. Avatar for maithra 21. maithra Lv 1 23 pts. 15,394
  2. Avatar for Steven Pletsch 22. Steven Pletsch Lv 1 21 pts. 15,391
  3. Avatar for BackBuffer 23. BackBuffer Lv 1 20 pts. 15,387
  4. Avatar for Idiotboy 24. Idiotboy Lv 1 18 pts. 15,385
  5. Avatar for georg137 25. georg137 Lv 1 16 pts. 15,379
  6. Avatar for jausmh 26. jausmh Lv 1 15 pts. 15,378
  7. Avatar for WBarme1234 27. WBarme1234 Lv 1 14 pts. 15,376
  8. Avatar for bamh 28. bamh Lv 1 12 pts. 15,373
  9. Avatar for RichGuilmain 29. RichGuilmain Lv 1 11 pts. 15,369
  10. Avatar for Wanderer09 30. Wanderer09 Lv 1 10 pts. 15,368

Comments