Icon representing a puzzle

2285: Revisiting Puzzle 74: Platypus Venom

Closed since almost 3 years ago

Novice Overall Prediction

Summary

Created
April 05, 2023
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small peptide was discovered in platypus venom-a rare instance of mammalian-produced venom, although this peptide appears similar to more widespread antimicrobials. This protein contains six cysteine residues that oxidize to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence
FVQHRPRDCESINGVCRHKDTVNCREIFLADCYNDGQKCCRK

Top groups

  1. Avatar for BOINC@Poland 11. BOINC@Poland 1 pt. 8,467
  2. Avatar for Trinity Biology 12. Trinity Biology 1 pt. 8,413
  3. Avatar for SP26 CHEM 351 Weldon 13. SP26 CHEM 351 Weldon 1 pt. 7,892
  4. Avatar for Q3 - Bioteknologi Protein 14. Q3 - Bioteknologi Protein 1 pt. 7,859
  5. Avatar for SHELL 15. SHELL 1 pt. 5,961
  1. Avatar for dcrwheeler
    1. dcrwheeler Lv 1
    100 pts. 9,786
  2. Avatar for Sandrix72 2. Sandrix72 Lv 1 95 pts. 9,732
  3. Avatar for BackBuffer 3. BackBuffer Lv 1 90 pts. 9,693
  4. Avatar for LociOiling 4. LociOiling Lv 1 85 pts. 9,673
  5. Avatar for Bruno Kestemont 5. Bruno Kestemont Lv 1 80 pts. 9,644
  6. Avatar for g_b 6. g_b Lv 1 76 pts. 9,611
  7. Avatar for christioanchauvin 7. christioanchauvin Lv 1 72 pts. 9,611
  8. Avatar for NinjaGreg 8. NinjaGreg Lv 1 68 pts. 9,592
  9. Avatar for akaaka 9. akaaka Lv 1 64 pts. 9,582
  10. Avatar for Vinara 10. Vinara Lv 1 60 pts. 9,540

Comments