Icon representing a puzzle

2285: Revisiting Puzzle 74: Platypus Venom

Closed since about 3 years ago

Novice Novice Novice Overall Overall Overall Prediction Prediction Prediction

Summary


Created
April 05, 2023
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small peptide was discovered in platypus venom-a rare instance of mammalian-produced venom, although this peptide appears similar to more widespread antimicrobials. This protein contains six cysteine residues that oxidize to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence
FVQHRPRDCESINGVCRHKDTVNCREIFLADCYNDGQKCCRK

Top groups


  1. Avatar for Go Science 100 pts. 9,732
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 70 pts. 9,673
  3. Avatar for L'Alliance Francophone 3. L'Alliance Francophone 47 pts. 9,611
  4. Avatar for Contenders 4. Contenders 30 pts. 9,505
  5. Avatar for FamilyBarmettler 5. FamilyBarmettler 19 pts. 9,481
  6. Avatar for Gargleblasters 6. Gargleblasters 11 pts. 9,344
  7. Avatar for Australia 7. Australia 7 pts. 9,246
  8. Avatar for Marvin's bunch 8. Marvin's bunch 4 pts. 9,217
  9. Avatar for AlphaFold 9. AlphaFold 2 pts. 8,700
  10. Avatar for VeFold 10. VeFold 1 pt. 8,478

  1. Avatar for dcrwheeler
    1. dcrwheeler Lv 1
    100 pts. 9,786
  2. Avatar for Sandrix72 2. Sandrix72 Lv 1 95 pts. 9,732
  3. Avatar for BackBuffer 3. BackBuffer Lv 1 90 pts. 9,693
  4. Avatar for LociOiling 4. LociOiling Lv 1 85 pts. 9,673
  5. Avatar for Bruno Kestemont 5. Bruno Kestemont Lv 1 80 pts. 9,644
  6. Avatar for g_b 6. g_b Lv 1 76 pts. 9,611
  7. Avatar for christioanchauvin 7. christioanchauvin Lv 1 72 pts. 9,611
  8. Avatar for NinjaGreg 8. NinjaGreg Lv 1 68 pts. 9,592
  9. Avatar for akaaka 9. akaaka Lv 1 64 pts. 9,582
  10. Avatar for Vinara 10. Vinara Lv 1 60 pts. 9,540

Comments