Icon representing a puzzle

2290: Revisiting Puzzle 75: Antifreeze Protein

Closed since almost 3 years ago

Novice Overall Prediction

Summary

Created
April 17, 2023
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This eelpout protein binds nucleated ice crystals to inhibit their growth. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence
ANQASVVANQLIPINTALTLVMMRSEVVTPVGIPAEDIPRLVSMQVNRAVPLGTTLMPDMVRGYAA

Top groups

  1. Avatar for Ogre's lab 11. Ogre's lab 1 pt. 9,617
  2. Avatar for VeFold 12. VeFold 1 pt. 9,518
  3. Avatar for Folders 13. Folders 1 pt. 9,285
  4. Avatar for Italiani Al Lavoro 14. Italiani Al Lavoro 1 pt. 9,281
  1. Avatar for WBarme1234 21. WBarme1234 Lv 1 27 pts. 10,024
  2. Avatar for Flagg65a 22. Flagg65a Lv 1 25 pts. 10,024
  3. Avatar for BootsMcGraw 23. BootsMcGraw Lv 1 23 pts. 10,016
  4. Avatar for NPrincipi 24. NPrincipi Lv 1 22 pts. 10,009
  5. Avatar for Steven Pletsch 25. Steven Pletsch Lv 1 20 pts. 10,008
  6. Avatar for christioanchauvin 26. christioanchauvin Lv 1 18 pts. 9,998
  7. Avatar for RichGuilmain 27. RichGuilmain Lv 1 17 pts. 9,998
  8. Avatar for phi16 28. phi16 Lv 1 16 pts. 9,987
  9. Avatar for georg137 29. georg137 Lv 1 14 pts. 9,978
  10. Avatar for jausmh 30. jausmh Lv 1 13 pts. 9,974

Comments