Icon representing a puzzle

2290: Revisiting Puzzle 75: Antifreeze Protein

Closed since almost 3 years ago

Novice Overall Prediction

Summary

Created
April 17, 2023
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This eelpout protein binds nucleated ice crystals to inhibit their growth. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence
ANQASVVANQLIPINTALTLVMMRSEVVTPVGIPAEDIPRLVSMQVNRAVPLGTTLMPDMVRGYAA

Top groups

  1. Avatar for Ogre's lab 11. Ogre's lab 1 pt. 9,617
  2. Avatar for VeFold 12. VeFold 1 pt. 9,518
  3. Avatar for Folders 13. Folders 1 pt. 9,285
  4. Avatar for Italiani Al Lavoro 14. Italiani Al Lavoro 1 pt. 9,281
  1. Avatar for Bletchley Park 31. Bletchley Park Lv 1 12 pts. 9,959
  2. Avatar for bamh 32. bamh Lv 1 11 pts. 9,945
  3. Avatar for 42022109 33. 42022109 Lv 1 10 pts. 9,933
  4. Avatar for AlkiP0Ps 34. AlkiP0Ps Lv 1 9 pts. 9,929
  5. Avatar for ucad 35. ucad Lv 1 9 pts. 9,908
  6. Avatar for blazegeek 36. blazegeek Lv 1 8 pts. 9,855
  7. Avatar for fpc 37. fpc Lv 1 7 pts. 9,802
  8. Avatar for zbp 38. zbp Lv 1 7 pts. 9,797
  9. Avatar for abiogenesis 39. abiogenesis Lv 1 6 pts. 9,792
  10. Avatar for kitsoune 40. kitsoune Lv 1 5 pts. 9,783

Comments