Icon representing a puzzle

2290: Revisiting Puzzle 75: Antifreeze Protein

Closed since almost 3 years ago

Novice Overall Prediction

Summary

Created
April 17, 2023
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This eelpout protein binds nucleated ice crystals to inhibit their growth. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence
ANQASVVANQLIPINTALTLVMMRSEVVTPVGIPAEDIPRLVSMQVNRAVPLGTTLMPDMVRGYAA

Top groups

  1. Avatar for Ogre's lab 11. Ogre's lab 1 pt. 9,617
  2. Avatar for VeFold 12. VeFold 1 pt. 9,518
  3. Avatar for Folders 13. Folders 1 pt. 9,285
  4. Avatar for Italiani Al Lavoro 14. Italiani Al Lavoro 1 pt. 9,281
  1. Avatar for OrganicTaylor 71. OrganicTaylor Lv 1 1 pt. 9,293
  2. Avatar for Zitronenfalter 72. Zitronenfalter Lv 1 1 pt. 9,285
  3. Avatar for pmthomson90 73. pmthomson90 Lv 1 1 pt. 9,281
  4. Avatar for superfilomeno 74. superfilomeno Lv 1 1 pt. 9,260
  5. Avatar for mart0258 75. mart0258 Lv 1 1 pt. 9,248
  6. Avatar for DextranC06 76. DextranC06 Lv 1 1 pt. 9,179
  7. Avatar for hi1000 77. hi1000 Lv 1 1 pt. 9,172
  8. Avatar for JJ38000 78. JJ38000 Lv 1 1 pt. 9,169
  9. Avatar for pizpot 79. pizpot Lv 1 1 pt. 9,168
  10. Avatar for Sci1017 80. Sci1017 Lv 1 1 pt. 9,072

Comments