Icon representing a puzzle

2290: Revisiting Puzzle 75: Antifreeze Protein

Closed since almost 3 years ago

Novice Overall Prediction

Summary

Created
April 17, 2023
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This eelpout protein binds nucleated ice crystals to inhibit their growth. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence
ANQASVVANQLIPINTALTLVMMRSEVVTPVGIPAEDIPRLVSMQVNRAVPLGTTLMPDMVRGYAA

Top groups

  1. Avatar for Ogre's lab 11. Ogre's lab 1 pt. 9,617
  2. Avatar for VeFold 12. VeFold 1 pt. 9,518
  3. Avatar for Folders 13. Folders 1 pt. 9,285
  4. Avatar for Italiani Al Lavoro 14. Italiani Al Lavoro 1 pt. 9,281
  1. Avatar for Elon 81. Elon Lv 1 1 pt. 9,032
  2. Avatar for unoboys5 82. unoboys5 Lv 1 1 pt. 8,914
  3. Avatar for WuWTq 83. WuWTq Lv 1 1 pt. 8,619
  4. Avatar for abskebabs 84. abskebabs Lv 1 1 pt. 8,308
  5. Avatar for klbklb 85. klbklb Lv 1 1 pt. 7,975
  6. Avatar for ljoseph 86. ljoseph Lv 1 1 pt. 0
  7. Avatar for Dorane 87. Dorane Lv 1 1 pt. 0

Comments