Placeholder image of a protein
Icon representing a puzzle

2293: Electron Density Reconstruction 37

Closed since almost 3 years ago

Novice Overall Prediction Electron Density

Summary

Created
April 21, 2023
Expires
Max points
100
Description

The structure of this protein has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model. This one has two copies of the same protein in it.

Sequence
CSRIWQSPRFIARKRGFTVKMHCYMNSASGNVSWLWKQEMDENPQQLKLEKGRMEESQNE SLATLTIQGIRFEDNGIYFCQQKCNNTSEVYQGCGTELRVMGF

Top groups

  1. Avatar for Eὕρηκα! Heureka! 11. Eὕρηκα! Heureka! 1 pt. 28,685
  2. Avatar for SHELL 12. SHELL 1 pt. 28,323
  3. Avatar for Folders 13. Folders 1 pt. 28,186
  4. Avatar for AlphaFold 14. AlphaFold 1 pt. 14,918
  1. Avatar for akaaka 11. akaaka Lv 1 54 pts. 31,209
  2. Avatar for christioanchauvin 12. christioanchauvin Lv 1 51 pts. 31,135
  3. Avatar for NinjaGreg 13. NinjaGreg Lv 1 47 pts. 31,124
  4. Avatar for Bletchley Park 14. Bletchley Park Lv 1 44 pts. 31,115
  5. Avatar for NPrincipi 15. NPrincipi Lv 1 41 pts. 31,110
  6. Avatar for MicElephant 16. MicElephant Lv 1 38 pts. 31,074
  7. Avatar for guineapig 17. guineapig Lv 1 36 pts. 31,057
  8. Avatar for blazegeek 18. blazegeek Lv 1 33 pts. 31,049
  9. Avatar for fpc 19. fpc Lv 1 31 pts. 31,044
  10. Avatar for WBarme1234 20. WBarme1234 Lv 1 29 pts. 30,998

Comments