Placeholder image of a protein
Icon representing a puzzle

2293: Electron Density Reconstruction 37

Closed since almost 3 years ago

Novice Overall Prediction Electron Density

Summary


Created
April 21, 2023
Expires
Max points
100
Description

The structure of this protein has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model. This one has two copies of the same protein in it.

Sequence
CSRIWQSPRFIARKRGFTVKMHCYMNSASGNVSWLWKQEMDENPQQLKLEKGRMEESQNE SLATLTIQGIRFEDNGIYFCQQKCNNTSEVYQGCGTELRVMGF

Top groups


  1. Avatar for Eὕρηκα! Heureka! 11. Eὕρηκα! Heureka! 1 pt. 28,685
  2. Avatar for SHELL 12. SHELL 1 pt. 28,323
  3. Avatar for Folders 13. Folders 1 pt. 28,186
  4. Avatar for AlphaFold 14. AlphaFold 1 pt. 14,918

  1. Avatar for kitsoune 41. kitsoune Lv 1 5 pts. 30,049
  2. Avatar for Wiz kid 42. Wiz kid Lv 1 4 pts. 30,035
  3. Avatar for matt61ger 43. matt61ger Lv 1 4 pts. 30,031
  4. Avatar for mengzach 44. mengzach Lv 1 3 pts. 29,999
  5. Avatar for mnucer 45. mnucer Lv 1 3 pts. 29,987
  6. Avatar for rezaefar 46. rezaefar Lv 1 3 pts. 29,975
  7. Avatar for sciencewalker 47. sciencewalker Lv 1 3 pts. 29,898
  8. Avatar for zbp 48. zbp Lv 1 2 pts. 29,766
  9. Avatar for Alistair69 49. Alistair69 Lv 1 2 pts. 29,720
  10. Avatar for ProfVince 50. ProfVince Lv 1 2 pts. 29,687

Comments