Placeholder image of a protein
Icon representing a puzzle

2293: Electron Density Reconstruction 37

Closed since almost 3 years ago

Novice Overall Prediction Electron Density

Summary

Created
April 21, 2023
Expires
Max points
100
Description

The structure of this protein has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model. This one has two copies of the same protein in it.

Sequence
CSRIWQSPRFIARKRGFTVKMHCYMNSASGNVSWLWKQEMDENPQQLKLEKGRMEESQNE SLATLTIQGIRFEDNGIYFCQQKCNNTSEVYQGCGTELRVMGF

Top groups

  1. Avatar for Eὕρηκα! Heureka! 11. Eὕρηκα! Heureka! 1 pt. 28,685
  2. Avatar for SHELL 12. SHELL 1 pt. 28,323
  3. Avatar for Folders 13. Folders 1 pt. 28,186
  4. Avatar for AlphaFold 14. AlphaFold 1 pt. 14,918
  1. Avatar for Swapper242 71. Swapper242 Lv 1 1 pt. 28,516
  2. Avatar for WhiteOwl000 72. WhiteOwl000 Lv 1 1 pt. 28,470
  3. Avatar for apetrides 73. apetrides Lv 1 1 pt. 28,432
  4. Avatar for lbuschmann 74. lbuschmann Lv 1 1 pt. 28,407
  5. Avatar for U202240095 75. U202240095 Lv 1 1 pt. 28,323
  6. Avatar for Zitronenfalter 76. Zitronenfalter Lv 1 1 pt. 28,186
  7. Avatar for furi0us 77. furi0us Lv 1 1 pt. 27,611
  8. Avatar for abskebabs 78. abskebabs Lv 1 1 pt. 27,585
  9. Avatar for ModemHail 79. ModemHail Lv 1 1 pt. 26,766
  10. Avatar for DipsyDoodle2016 80. DipsyDoodle2016 Lv 1 1 pt. 22,467

Comments