Beginner Puzzle: Easy Mini Freestyle

Closed since almost 3 years ago

Summary

• Created: May 01, 2023
• Expires: June 15, 2023 at 22:00 UTC
• Max points: 100

Description

We are giving you this currently unsolved short protein as an extended chain. It has only 48 residues and we're posting it with no secondary structure predictions. This is a Beginner puzzle for new players that have joined Foldit in the last 6 months.

• Sequence: STMEKSVLGGQDQLRVRVTELEDEVRNLRKINRDLFDFSTRFITRPAK

Top groups

• 1. Go Science 100 pts. 8,163
• 2. Villanova ChE 24 pts. 7,239
• 3. DSN @ Home 4 pts. 6,512
• 4. SHELL 1 pt. 6,469
• 5. CH4110 Fold it! 1 pt. 6,231

Top evolvers

No scores of this type to display!