Icon representing a puzzle

Beginner Puzzle: Easy Mini Freestyle

Closed since over 2 years ago

Beginner

Summary

Created
May 01, 2023
Expires
Max points
100
Description

We are giving you this currently unsolved short protein as an extended chain. It has only 48 residues and we're posting it with no secondary structure predictions. This is a Beginner puzzle for new players that have joined Foldit in the last 6 months.

Sequence
STMEKSVLGGQDQLRVRVTELEDEVRNLRKINRDLFDFSTRFITRPAK

Top groups

  1. Avatar for Go Science
    1. Go Science
    100 pts. 8,163
  2. Avatar for Villanova ChE 2. Villanova ChE 24 pts. 7,239
  3. Avatar for DSN @ Home 3. DSN @ Home 4 pts. 6,512
  4. Avatar for SHELL 4. SHELL 1 pt. 6,469
  5. Avatar for CH4110 Fold it! 5. CH4110 Fold it! 1 pt. 6,231
  1. Avatar for rosie4loop
    1. rosie4loop Lv 1
    100 pts. 8,851
  2. Avatar for Johannes S. 2. Johannes S. Lv 1 91 pts. 8,361
  3. Avatar for CO 3. CO Lv 1 83 pts. 8,281
  4. Avatar for davitzeiro42 4. davitzeiro42 Lv 1 75 pts. 8,216
  5. Avatar for gogona 5. gogona Lv 1 68 pts. 8,163
  6. Avatar for karl07 6. karl07 Lv 1 61 pts. 8,123
  7. Avatar for ianbambooman6 7. ianbambooman6 Lv 1 55 pts. 7,830
  8. Avatar for Anne_sph 8. Anne_sph Lv 1 49 pts. 7,828
  9. Avatar for ricemilkk_ 9. ricemilkk_ Lv 1 44 pts. 7,768
  10. Avatar for ml4268 10. ml4268 Lv 1 39 pts. 7,696

Comments