LociOiling Lv 1
Tiny little puzzle this week, only one chain, 65 segments. It matches PDB 5FGM.
2300: Electron Density Reconstruction 39
Closed since almost 3 years ago
Novice Overall Prediction Electron DensitySummary
- Created
- May 08, 2023
- Expires
- Max points
- 100
The structure of this protein has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model.
- Sequence
- GSHMLPDSDVKQALQAIPEEFRIAVYLADVEGFAYKEIADIMGTPIGTVMSRLHRGRRQLRGMLEDYAR