Placeholder image of a protein
Icon representing a puzzle

2300: Electron Density Reconstruction 39

Closed since almost 3 years ago

Novice Novice Novice Novice Overall Overall Overall Overall Prediction Prediction Prediction Prediction Electron Density Electron Density Electron Density Electron Density

Summary


Created
May 08, 2023
Expires
Max points
100
Description

The structure of this protein has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model.

Sequence
GSHMLPDSDVKQALQAIPEEFRIAVYLADVEGFAYKEIADIMGTPIGTVMSRLHRGRRQLRGMLEDYAR

Top groups


  1. Avatar for Go Science 100 pts. 15,669
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 65 pts. 15,665
  3. Avatar for Marvin's bunch 3. Marvin's bunch 41 pts. 15,652
  4. Avatar for Contenders 4. Contenders 24 pts. 15,649
  5. Avatar for FamilyBarmettler 5. FamilyBarmettler 14 pts. 15,627
  6. Avatar for L'Alliance Francophone 6. L'Alliance Francophone 7 pts. 15,543
  7. Avatar for Australia 7. Australia 4 pts. 15,401
  8. Avatar for BOINC@Poland 8. BOINC@Poland 2 pts. 15,343
  9. Avatar for VeFold 9. VeFold 1 pt. 15,223
  10. Avatar for Italiani Al Lavoro 10. Italiani Al Lavoro 1 pt. 15,118

  1. Avatar for LociOiling
    1. LociOiling Lv 1
    100 pts. 15,665
  2. Avatar for blazegeek 2. blazegeek Lv 1 94 pts. 15,660
  3. Avatar for BackBuffer 3. BackBuffer Lv 1 88 pts. 15,659
  4. Avatar for Sandrix72 4. Sandrix72 Lv 1 82 pts. 15,658
  5. Avatar for grogar7 5. grogar7 Lv 1 77 pts. 15,657
  6. Avatar for Galaxie 6. Galaxie Lv 1 72 pts. 15,656
  7. Avatar for fpc 7. fpc Lv 1 67 pts. 15,652
  8. Avatar for Steven Pletsch 8. Steven Pletsch Lv 1 63 pts. 15,652
  9. Avatar for Bruno Kestemont 9. Bruno Kestemont Lv 1 58 pts. 15,651
  10. Avatar for dcrwheeler 10. dcrwheeler Lv 1 54 pts. 15,650

Comments