Placeholder image of a protein
Icon representing a puzzle

2300: Electron Density Reconstruction 39

Closed since almost 3 years ago

Novice Overall Prediction Electron Density

Summary

Created
May 08, 2023
Expires
Max points
100
Description

The structure of this protein has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model.

Sequence
GSHMLPDSDVKQALQAIPEEFRIAVYLADVEGFAYKEIADIMGTPIGTVMSRLHRGRRQLRGMLEDYAR

Top groups

  1. Avatar for Go Science
    1. Go Science
    100 pts. 15,669
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 65 pts. 15,665
  3. Avatar for Marvin's bunch 3. Marvin's bunch 41 pts. 15,652
  4. Avatar for Contenders 4. Contenders 24 pts. 15,649
  5. Avatar for FamilyBarmettler 5. FamilyBarmettler 14 pts. 15,627
  6. Avatar for L'Alliance Francophone 6. L'Alliance Francophone 7 pts. 15,543
  7. Avatar for Australia 7. Australia 4 pts. 15,401
  8. Avatar for BOINC@Poland 8. BOINC@Poland 2 pts. 15,343
  9. Avatar for VeFold 9. VeFold 1 pt. 15,223
  10. Avatar for Italiani Al Lavoro 10. Italiani Al Lavoro 1 pt. 15,118
  1. Avatar for Bruno Kestemont
    1. Bruno Kestemont Lv 1
    100 pts. 15,669
  2. Avatar for Sandrix72 2. Sandrix72 Lv 1 47 pts. 15,669
  3. Avatar for toshiue 3. toshiue Lv 1 19 pts. 15,669
  4. Avatar for silent gene 4. silent gene Lv 1 7 pts. 15,665
  5. Avatar for LociOiling 5. LociOiling Lv 1 2 pts. 15,663
  6. Avatar for Galaxie 6. Galaxie Lv 1 1 pt. 15,660
  7. Avatar for phi16 7. phi16 Lv 1 1 pt. 15,642
  8. Avatar for alcor29 8. alcor29 Lv 1 1 pt. 15,642

Comments